RetrogeneDB ID: | retro_ecab_616 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
Coordinates: | 23:23141938..23142129(-) | ||
Located in intron of: | ENSECAG00000023609 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | YPEL2 | ||
Ensembl ID: | ENSECAG00000018575 | ||
Aliases: | None | ||
Description: | yippee-like 2 (Drosophila) [Source:HGNC Symbol;Acc:18326] |
Percent Identity: | 63.08 % |
Parental protein coverage: | 53.78 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | MVKMTRSKTFQAYLPSCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSV-VNVGCGPAEE |
M.KMT.SKT.Q.YLP.C...Y.CIH..AHLAN...LISKSF..SQ..A.LFNSV.V.V.CGP.E. | |
Retrocopy | MIKMTNSKTCQGYLPNCP*IYCCIHWKAHLANPAVLISKSFHVSQHQAHLFNSV<VKVACGPGED |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP021940_articular_cartilage | 0 .00 RPM | 8 .03 RPM |
SRP021940_cerebellum | 0 .00 RPM | 19 .89 RPM |
SRP021940_embryo | 0 .00 RPM | 10 .56 RPM |
SRP021940_placental_villous | 0 .00 RPM | 17 .61 RPM |
SRP021940_synovial_membrane | 0 .00 RPM | 25 .20 RPM |
SRP021940_testis | 0 .00 RPM | 10 .55 RPM |
Species | RetrogeneDB ID |
---|---|
Callithrix jacchus | retro_cjac_597 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Equus caballus | ENSECAG00000018575 | 1 retrocopy |
retro_ecab_616 ,
|
Otolemur garnettii | ENSOGAG00000029581 | 1 retrocopy | |
Sorex araneus | ENSSARG00000009791 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000001013 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000013138 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000005518 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000000381 | 1 retrocopy |