RetrogeneDB ID: | retro_sara_318 | ||
Retrocopylocation | Organism: | Shrew (Sorex araneus) | |
Coordinates: | scaffold_160120:941..1181(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | YPEL2 | ||
Ensembl ID: | ENSSARG00000009791 | ||
Aliases: | None | ||
Description: | yippee-like 2 (Drosophila) [Source:HGNC Symbol;Acc:18326] |
Percent Identity: | 85. % |
Parental protein coverage: | 67.23 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | SFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKYIIEL |
S.QGSQG..YLFN.VVN.G.GPA.ERVLLTGLHAVADIYC.N.KTTLGWKYEHAFESSQKYKEG.Y.IEL | |
Retrocopy | SLQGSQGCVYLFNLVVNMGHGPAKERVLLTGLHAVADIYCDNYKTTLGWKYEHAFESSQKYKEGEYFIEL |
Parental | AHMIKDNGWD |
.HMIKDNGWD | |
Retrocopy | EHMIKDNGWD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Equus caballus | ENSECAG00000018575 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000029581 | 1 retrocopy | |
Sorex araneus | ENSSARG00000009791 | 2 retrocopies |
retro_sara_318 , retro_sara_650,
|
Ictidomys tridecemlineatus | ENSSTOG00000001013 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000013138 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000005518 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000000381 | 1 retrocopy |