RetrogeneDB ID: | retro_ecab_720 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
Coordinates: | 3:61904142..61904475(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C11orf73 | ||
Ensembl ID: | ENSECAG00000015605 | ||
Aliases: | None | ||
Description: | chromosome 11 open reading frame 73 [Source:HGNC Symbol;Acc:26938] |
Percent Identity: | 58.97 % |
Parental protein coverage: | 58.38 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 2 |
Parental | KISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQTPVGNAAVSSVDSFTQFTQK-MLDNFYN |
KI..LKSGEGS.HP.GAMNIV.TPSVA.IGIS..L....A....VG.AA.S..DSFTQ...K....N.Y. | |
Retrocopy | KIACLKSGEGSRHPSGAMNIVQTPSVALIGISADLQTQTA----VGDAADSLADSFTQPSMK<TWGNVYC |
Parental | FASSFAVSQAQMTPSPSEMFIPANV-VLKWYENFQRRLAQNPLFWKT |
.ASSFA.S.A.MTP.PSE.FIPA.......YENFQR.L...PL..KT | |
Retrocopy | SASSFALSEA*MTPNPSEFFIPASE>LSQRYENFQR*LTLSPLL*KT |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP021940_articular_cartilage | 0 .00 RPM | 7 .73 RPM |
SRP021940_cerebellum | 0 .00 RPM | 13 .40 RPM |
SRP021940_embryo | 0 .00 RPM | 18 .62 RPM |
SRP021940_placental_villous | 0 .00 RPM | 14 .96 RPM |
SRP021940_synovial_membrane | 0 .00 RPM | 11 .12 RPM |
SRP021940_testis | 0 .06 RPM | 8 .76 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Equus caballus | ENSECAG00000015605 | 1 retrocopy |
retro_ecab_720 ,
|
Homo sapiens | ENSG00000149196 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000023168 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000016260 | 1 retrocopy | |
Mus musculus | ENSMUSG00000062797 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000016224 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000013108 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000003746 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000004144 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000009192 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000012267 | 1 retrocopy |