RetrogeneDB ID: | retro_eeur_216 | ||
Retrocopy location | Organism: | Hedgehog (Erinaceus europaeus) | |
| Coordinates: | scaffold_211488:219..555(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MAX | ||
| Ensembl ID: | ENSEEUG00000003973 | ||
| Aliases: | None | ||
| Description: | MYC associated factor X [Source:HGNC Symbol;Acc:6913] |
| Percent Identity: | 89.47 % |
| Parental protein coverage: | 80.29 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 3 |
| Parental | ADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQQDIDDL-KR |
| .DKRAHHNALERKRRDHIKDSFHSLRD.VPSLQGEKA..AQILDKATEYIQYMRRKNHTHQQDIDDL.KR | |
| Retrocopy | SDKRAHHNALERKRRDHIKDSFHSLRDLVPSLQGEKATQAQILDKATEYIQYMRRKNHTHQQDIDDL>KR |
| Parental | QNALLE-QQVRAL-EKARSSAQLQTNYPSSD-SLYTNAKGSTIS |
| QNALLE..QV.AL.EKARSSAQLQT.YPSSD.SLYTN.KGSTIS | |
| Retrocopy | QNALLE>MQVHAL>EKARSSAQLQTYYPSSDISLYTNDKGSTIS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .97 RPM | 19 .18 RPM |
| SRP017611_kidney | 0 .75 RPM | 19 .13 RPM |
| SRP017611_liver | 0 .64 RPM | 8 .68 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000003472 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000016212 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000019702 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000010172 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000003973 | 3 retrocopies |
retro_eeur_216 , retro_eeur_344, retro_eeur_37,
|
| Echinops telfairi | ENSETEG00000002967 | 1 retrocopy | |
| Felis catus | ENSFCAG00000010347 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000004341 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000006859 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000059436 | 8 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000014373 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000016245 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000005911 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000008049 | 3 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000028142 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000012645 | 1 retrocopy |