RetrogeneDB ID: | retro_fcat_278 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
Coordinates: | A1:165379030..165379442(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MAX | ||
Ensembl ID: | ENSFCAG00000010347 | ||
Aliases: | None | ||
Description: | Protein max [Source:UniProtKB/Swiss-Prot;Acc:P61245] |
Percent Identity: | 67.39 % |
Parental protein coverage: | 92.57 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | QPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQQD |
Q.RFQSA.DK.A.HN.LE.K.R.HIKD.FH.L.D.V.SLQG..A..A.I.DKATEYIQ...RKNHTHQQD | |
Retrocopy | QLRFQSAYDKQALHNTLE*KHRNHIKDGFHGLWDLVLSLQGQQALWAEIPDKATEYIQHTQRKNHTHQQD |
Parental | IDDLKRQNALLE-QQVRALEKARSSAQLQTNYPSSDNSLYTNAKGSTISAFDGGSDSSSESEPEEPQS |
.DDL..QN.LLE.QQ..ALE.ARS..Q.QTNYP.SDN.LYTNAKGST...FD..SDSSS.SEP....S | |
Retrocopy | TDDLE*QNTLLE>QQALALEEARSNVQIQTNYPCSDNHLYTNAKGSTTHTFDRRSDSSSMSEPKAERS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 13 .54 RPM |
SRP017611_kidney | 0 .00 RPM | 8 .14 RPM |
SRP017611_liver | 0 .00 RPM | 5 .56 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000003472 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000016212 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000019702 | 2 retrocopies | |
Cavia porcellus | ENSCPOG00000010172 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000003973 | 3 retrocopies | |
Echinops telfairi | ENSETEG00000002967 | 1 retrocopy | |
Felis catus | ENSFCAG00000010347 | 1 retrocopy |
retro_fcat_278 ,
|
Macaca mulatta | ENSMMUG00000004341 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000006859 | 3 retrocopies | |
Mus musculus | ENSMUSG00000059436 | 8 retrocopies | |
Nomascus leucogenys | ENSNLEG00000014373 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000016245 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000005911 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000008049 | 3 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000028142 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000012645 | 1 retrocopy |