RetrogeneDB ID: | retro_rnor_1653 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 2:157693070..157693379(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Max | ||
| Ensembl ID: | ENSRNOG00000008049 | ||
| Aliases: | None | ||
| Description: | Protein max [Source:UniProtKB/Swiss-Prot;Acc:P52164] |
| Percent Identity: | 79.61 % |
| Parental protein coverage: | 68.21 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | HNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQ |
| .NALE.K.RD.I.DSFHSLRDSVPSLQG...S..Q.LDKATEYIQ.MRRKNHTHQ.D.D.LK.QNALLEQ | |
| Retrocopy | NNALEQKLRDYIRDSFHSLRDSVPSLQGQNTS*TQMLDKATEYIQCMRRKNHTHQKDVDVLKWQNALLEQ |
| Parental | QVRALEKARSSAQLQTNYPSSDNSLYTNAKGGT |
| QV..LE.AR.SAQLQTNYPSSDNSLYTN.KGGT | |
| Retrocopy | QVHTLENARLSAQLQTNYPSSDNSLYTNTKGGT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 36 .16 RPM |
| SRP017611_kidney | 0 .00 RPM | 29 .94 RPM |
| SRP017611_liver | 0 .00 RPM | 17 .82 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000003472 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000016212 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000019702 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000010172 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000003973 | 3 retrocopies | |
| Echinops telfairi | ENSETEG00000002967 | 1 retrocopy | |
| Felis catus | ENSFCAG00000010347 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000004341 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000006859 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000059436 | 8 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000014373 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000016245 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000005911 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000008049 | 3 retrocopies |
retro_rnor_1653 , retro_rnor_1877, retro_rnor_2369,
|
| Ictidomys tridecemlineatus | ENSSTOG00000028142 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000012645 | 1 retrocopy |