RetrogeneDB ID: | retro_mmul_1648 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 3:173166843..173167238(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.1995 | ||
| Ensembl ID: | ENSMMUG00000004341 | ||
| Aliases: | None | ||
| Description: | protein max [Source:RefSeq peptide;Acc:NP_001248298] |
| Percent Identity: | 73.72 % |
| Parental protein coverage: | 83.75 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 3 |
| Parental | HHNALERKRRDHI-KDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNH-THQQDIDDL-KRQNA |
| HH.ALE..RRDHI.K..F.SL.DSVP.LQGEKAS.AQILDKA.EYIQ.M.R....T.Q..IDDL..R.NA | |
| Retrocopy | HHDALE*NRRDHI>KAAF-SLWDSVPILQGEKASGAQILDKAIEYIQHMWREKP<TRQ*EIDDL<QR*NA |
| Parental | LLEQQVRALEKARSSAQLQTNYPSSDNSLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS |
| LL.Q.VRAL.K.RSSAQ.Q.NYPSSD..LYTNAKGST.SAFDGGSDSSSE.E.EEP.SRKKL.MEAS | |
| Retrocopy | LLKQEVRAL-KGRSSAQPQANYPSSDSILYTNAKGSTTSAFDGGSDSSSELEHEEP*SRKKLQMEAS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .22 RPM | 38 .32 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .08 RPM | 37 .92 RPM |
| SRP007412_cerebellum | 0 .32 RPM | 57 .60 RPM |
| SRP007412_heart | 0 .00 RPM | 25 .20 RPM |
| SRP007412_kidney | 0 .00 RPM | 30 .05 RPM |
| SRP007412_liver | 0 .00 RPM | 15 .75 RPM |
| SRP007412_testis | 0 .11 RPM | 23 .86 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Pongo abelii | retro_pabe_3097 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000003472 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000016212 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000019702 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000010172 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000003973 | 3 retrocopies | |
| Echinops telfairi | ENSETEG00000002967 | 1 retrocopy | |
| Felis catus | ENSFCAG00000010347 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000004341 | 1 retrocopy |
retro_mmul_1648 ,
|
| Mustela putorius furo | ENSMPUG00000006859 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000059436 | 8 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000014373 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000016245 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000005911 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000008049 | 3 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000028142 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000012645 | 1 retrocopy |