RetrogeneDB ID: | retro_etel_1500 | ||
Retrocopylocation | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
Coordinates: | scaffold_274937:1987..2194(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | UBE2C | ||
Ensembl ID: | ENSETEG00000012346 | ||
Aliases: | None | ||
Description: | ubiquitin-conjugating enzyme E2C [Source:HGNC Symbol;Acc:15937] |
Percent Identity: | 75.36 % |
Parental protein coverage: | 70.41 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | ARGSVGKXXXXXXXXXXMSDDKGISAFPESDNLFKWIGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPT |
AR..VGK..........MS.DKGISAF.ESDNLFKWIGTIHGAAGTVYE.LRYKLSLEFPS.YPYNA.T | |
Retrocopy | ARVFVGKRLQQELMTLMMSGDKGISAFLESDNLFKWIGTIHGAAGTVYENLRYKLSLEFPSSYPYNAST |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Cavia porcellus | ENSCPOG00000014102 | 2 retrocopies | |
Echinops telfairi | ENSETEG00000012346 | 18 retrocopies | |
Loxodonta africana | ENSLAFG00000003164 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000021023 | 4 retrocopies | |
Monodelphis domestica | ENSMODG00000013661 | 6 retrocopies | |
Mustela putorius furo | ENSMPUG00000017619 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000004989 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000013564 | 1 retrocopy |