RetrogeneDB ID: | retro_etel_1500 | ||
Retrocopy location | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | scaffold_274937:1987..2194(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | UBE2C | ||
| Ensembl ID: | ENSETEG00000012346 | ||
| Aliases: | None | ||
| Description: | ubiquitin-conjugating enzyme E2C [Source:HGNC Symbol;Acc:15937] |
| Percent Identity: | 75.36 % |
| Parental protein coverage: | 70.41 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | ARGSVGKXXXXXXXXXXMSDDKGISAFPESDNLFKWIGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPT |
| AR..VGK..........MS.DKGISAF.ESDNLFKWIGTIHGAAGTVYE.LRYKLSLEFPS.YPYNA.T | |
| Retrocopy | ARVFVGKRLQQELMTLMMSGDKGISAFLESDNLFKWIGTIHGAAGTVYENLRYKLSLEFPSSYPYNAST |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Cavia porcellus | ENSCPOG00000014102 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000012346 | 18 retrocopies | |
| Loxodonta africana | ENSLAFG00000003164 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000021023 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000013661 | 6 retrocopies | |
| Mustela putorius furo | ENSMPUG00000017619 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000004989 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000013564 | 1 retrocopy |