RetrogeneDB ID: | retro_fcat_1139 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
Coordinates: | C1:159104931..159105276(+) | ||
Located in intron of: | ENSFCAG00000012076 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | H1FOO | ||
Ensembl ID: | ENSFCAG00000000094 | ||
Aliases: | None | ||
Description: | H1 histone family, member O, oocyte-specific [Source:HGNC Symbol;Acc:18463] |
Percent Identity: | 68.7 % |
Parental protein coverage: | 54.81 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | KSKVKGRRSNQDGEAHRKTKAGSQNSKSTVPKDKNSVASPAKKKENKVLKEVVACGAKVGPKAKATAPPR |
..K..GRRS.QDGEA.RKTKA.S..SKS.VPKDKNS.ASPAKKKE.KV.KEVVA.G.K.GPKAKA.A.PR | |
Retrocopy | ENKTNGRRSSQDGEAPRKTKAESWSSKSMVPKDKNSAASPAKKKEDKVPKEVVAHGVKEGPKAKAPATPR |
Parental | ASGSKTVPAPLARKTGAPKGPRKP-CMPTKASSSKLASKKTEAES |
..GSK.V..PLARKT.AP.....P.C..TKASS..LASKK.E.ES | |
Retrocopy | GGGSKRVSGPLARKTEAPRAQEGPACRITKASSFRLASKKLETES |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 0 .00 RPM |
SRP017611_kidney | 0 .00 RPM | 0 .00 RPM |
SRP017611_liver | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000017209 | 2 retrocopies | |
Felis catus | ENSFCAG00000000094 | 2 retrocopies |
retro_fcat_1139 , retro_fcat_416,
|
Homo sapiens | ENSG00000178804 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000000735 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000025226 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000029379 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000010371 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000013414 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000015380 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000007110 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000011276 | 1 retrocopy |