RetrogeneDB ID: | retro_fcat_1634 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | D4:57345999..57346205(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MAP1LC3A | ||
| Ensembl ID: | ENSFCAG00000022040 | ||
| Aliases: | None | ||
| Description: | microtubule-associated protein 1 light chain 3 alpha [Source:HGNC Symbol;Acc:6838] |
| Percent Identity: | 67.14 % |
| Parental protein coverage: | 54.84 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MPSDRPFKQRRTFADRCKEVQQIRDQ-HPSKIPVIIERYKGEKQ-LPVLDKTKFLVPDHVNMSELVKIIR |
| MPS...FKQ..TF..R...V..IR...HP.KIPVIIE.YKGE...LPVLDKTKFLVPDH.NMSEL.KI.R | |
| Retrocopy | MPSEKIFKQHHTFQQRTEDVRLIREPPHPMKIPVIIEQYKGESY<LPVLDKTKFLVPDHINMSELIKIFR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 37 .42 RPM |
| SRP017611_kidney | 0 .00 RPM | 16 .08 RPM |
| SRP017611_liver | 0 .00 RPM | 4 .25 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Echinops telfairi | ENSETEG00000012407 | 1 retrocopy | |
| Felis catus | ENSFCAG00000001938 | 4 retrocopies | |
| Felis catus | ENSFCAG00000022040 | 1 retrocopy |
retro_fcat_1634 ,
|
| Monodelphis domestica | ENSMODG00000002694 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000017814 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000006158 | 2 retrocopies |