RetrogeneDB ID: | retro_fcat_379 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
Coordinates: | A2:69166711..69167087(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RNF138 | ||
Ensembl ID: | ENSFCAG00000014180 | ||
Aliases: | None | ||
Description: | ring finger protein 138, E3 ubiquitin protein ligase [Source:HGNC Symbol;Acc:17765] |
Percent Identity: | 51.56 % |
Parental protein coverage: | 51.02 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 3 |
Parental | VRTAACQHVFC-RKCFLTAMRESGIHCPLCRGNVTRRERACPERALDLENIMRKFSGSCRCCA-KQIKFY |
..T...QH.FC..K...T.MRES.I.C..C..N.TRRE..C.E.....EN..R.FS.S...C..KQIKF. | |
Retrocopy | LQTVTWQHFFC>TKMCPTEMRESAINCHFCHKNMTRREKSCLE*TSHIENVTREFSTSRGSCK<KQIKF* |
Parental | RMRHHYKSCKKYQDEYGVSSIIPNFQISQDSVGN-SNRSETSTSDNTETYQENTSSSG |
R.R.HYKS.KK.QD.Y...SII...QISQ.S.GN..N.SE.ST.D..E..Q..T.SSG | |
Retrocopy | RQRYHYKSYKKDQDGYRAASIIRTSQISQGSAGN>LNKSEASTTDSRENSQGDTLSSG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 7 .35 RPM |
SRP017611_kidney | 0 .00 RPM | 4 .43 RPM |
SRP017611_liver | 0 .00 RPM | 3 .54 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000020160 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000012689 | 6 retrocopies | |
Callithrix jacchus | ENSCJAG00000020875 | 1 retrocopy | |
Felis catus | ENSFCAG00000014180 | 2 retrocopies |
retro_fcat_1383, retro_fcat_379 ,
|
Homo sapiens | ENSG00000134758 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000027857 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000003811 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000010850 | 4 retrocopies | |
Mustela putorius furo | ENSMPUG00000006982 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000006401 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000009094 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000009956 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000003778 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000015645 | 3 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000002293 | 2 retrocopies |