RetrogeneDB ID: | retro_fcat_590 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
Coordinates: | B1:166268200..166268434(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | COX7B | ||
Ensembl ID: | ENSFCAG00000023091 | ||
Aliases: | None | ||
Description: | cytochrome c oxidase subunit VIIb [Source:HGNC Symbol;Acc:2291] |
Percent Identity: | 68.75 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MFPMARNAFSRLRVQSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCVAVWAYTATQIGIEWNLSPVG |
MF...RNA..R....SIQQ...RQSH.K..PDFHDKYGN.VLASG..FCV..W..TATQIGIEWNLSPVG | |
Retrocopy | MFLLTRNALRRFKIRSIQQI--RQSHEKHSPDFHDKYGNIVLASGSAFCVVAWVFTATQIGIEWNLSPVG |
Parental | RVTPKEWRDQ |
RVTP.EW.D. | |
Retrocopy | RVTPEEWNDK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 63 .93 RPM |
SRP017611_kidney | 0 .10 RPM | 148 .61 RPM |
SRP017611_liver | 0 .00 RPM | 58 .03 RPM |