RetrogeneDB ID: | retro_mmus_2731 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 6:50967265..50967507(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Cox7b | ||
| Ensembl ID: | ENSMUSG00000031231 | ||
| Aliases: | Cox7b, 1100001F07Rik, 1110004F07Rik, C80563 | ||
| Description: | cytochrome c oxidase subunit VIIb [Source:MGI Symbol;Acc:MGI:1913392] |
| Percent Identity: | 85.37 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | MLPLAKN-ALSRLQVRSIQQVVARQSHQKRAPSFHDKYGNAILAGGAIFCVSTWTYTATQIGIEWNMSPV |
| MLPLAK..AL.RLQVRSIQQVVAR.SHQKR..SFHDKYGNAILA.G.IFCVSTWT.TATQ.GIEWN.SPV | |
| Retrocopy | MLPLAKK>ALRRLQVRSIQQVVARPSHQKRTLSFHDKYGNAILADGGIFCVSTWTHTATQVGIEWNLSPV |
| Parental | GRVT-PKEWRDQ |
| GRVT.PKEWRDQ | |
| Retrocopy | GRVT>PKEWRDQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 100 .97 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 108 .08 RPM |
| SRP007412_heart | 0 .00 RPM | 430 .53 RPM |
| SRP007412_kidney | 0 .00 RPM | 240 .39 RPM |
| SRP007412_liver | 0 .00 RPM | 132 .50 RPM |
| SRP007412_testis | 0 .00 RPM | 3 .61 RPM |