RetrogeneDB ID: | retro_mmul_571 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 1:192899362..192899602(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MMU.84 | ||
Ensembl ID: | ENSMMUG00000015861 | ||
Aliases: | None | ||
Description: | cytochrome c oxidase subunit 7B, mitochondrial [Source:RefSeq peptide;Acc:NP_001245069] |
Percent Identity: | 80. % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MFPLVKNALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLAGGATFCIATWTYVATQIGIEWNLSPVG |
MFPLVK..L..L.V.SIQQ.MARQSHQKRT.DFHDK.GNAVLA.G.TFCIA.WTYVATQIGI..NLSPVG | |
Retrocopy | MFPLVKTSLSHLHVPSIQQIMARQSHQKRTSDFHDKGGNAVLANGDTFCIAVWTYVATQIGIIGNLSPVG |
Parental | RVTPKEWRNQ |
RVT.KEWR.Q | |
Retrocopy | RVTLKEWRDQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 82 .92 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 87 .10 RPM |
SRP007412_cerebellum | 0 .00 RPM | 87 .43 RPM |
SRP007412_heart | 0 .00 RPM | 217 .52 RPM |
SRP007412_kidney | 0 .00 RPM | 205 .86 RPM |
SRP007412_liver | 0 .00 RPM | 146 .42 RPM |
SRP007412_testis | 0 .04 RPM | 6 .78 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_462 |
Pan troglodytes | retro_ptro_349 |
Gorilla gorilla | retro_ggor_443 |
Pongo abelii | retro_pabe_270 |