RetrogeneDB ID: | retro_fcat_727 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
Coordinates: | B2:109471562..109471914(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSFCAG00000028856 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 76.27 % |
Parental protein coverage: | 71.6 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | PGCSKTHLPGFVEQAEALKAKGAQVIACLSVNDVFVTTEWGRAHNSGGKVRLLADPTGAFGKETG-LLLD |
P.CSK.HLPGF..QAEALKAKG.QV.A.LSVNDVFV..EWG.AHNSG.KVRLLAD..G.F.KET..LL.D | |
Retrocopy | PRCSKIHLPGFMHQAEALKAKGVQVVAYLSVNDVFVAEEWGQAHNSGDKVRLLADSLGTFRKETDLLLGD |
Parental | -DSLVSLFGNRRLKRFSMVVEDGVVKSLNVEPDGTGLTCSLASNIISQ |
.DSLVSLFGN..LKRFSMVVEDG.VKSLNVE.D..G..CSLA.NIISQ | |
Retrocopy | >DSLVSLFGNPLLKRFSMVVEDGIVKSLNVELDDRGFICSLAPNIISQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 84 .59 RPM |
SRP017611_kidney | 0 .00 RPM | 184 .37 RPM |
SRP017611_liver | 0 .00 RPM | 31 .44 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000008648 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000018014 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000004647 | 1 retrocopy | |
Equus caballus | ENSECAG00000017747 | 2 retrocopies | |
Echinops telfairi | ENSETEG00000000264 | 3 retrocopies | |
Felis catus | ENSFCAG00000028856 | 3 retrocopies |
retro_fcat_1189, retro_fcat_410, retro_fcat_727 ,
|
Homo sapiens | ENSG00000126432 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000001337 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000025661 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000013397 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000005003 | 2 retrocopies | |
Procavia capensis | ENSPCAG00000010811 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000003106 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000003835 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000013030 | 2 retrocopies |