RetrogeneDB ID: | retro_ecab_844 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
Coordinates: | 5:86200054..86200417(+) | ||
Located in intron of: | ENSECAG00000026840 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PRDX5 | ||
Ensembl ID: | ENSECAG00000017747 | ||
Aliases: | None | ||
Description: | peroxiredoxin 5 [Source:HGNC Symbol;Acc:9355] |
Percent Identity: | 55.91 % |
Parental protein coverage: | 77.02 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 3 |
Parental | GVPGAFTPGCSKTHL-PGFVEQAAA-LKAKGVEVVACLTVNDVFVTEEWGRAHNTKGKVRLLADPTGAF- |
G..G...PG.S..H...GFV.QA....KAKGV....CL.V..VFVT.E...AHN..GKV.LLA...G... | |
Retrocopy | GQEGSLYPGMSQDHV<AGFVDQAGM<VKAKGV-LSPCLSVS-VFVTGEREQAHNMEGKVQLLANTLGSL< |
Parental | GKETDLLLDDSLVSLFGNRRLKRFSMVIEDGIVKSLNVEPDGTGLTCSLAPNIISQL |
GKETDLLLDDSL..LFG...LK..SMV.....VK..N.EP...GLTCSLAPNII.Q. | |
Retrocopy | GKETDLLLDDSL*PLFGDE*LKSLSMVVDNSVVKGRNEEPNDAGLTCSLAPNIILQI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP021940_articular_cartilage | 0 .00 RPM | 87 .36 RPM |
SRP021940_cerebellum | 0 .00 RPM | 169 .09 RPM |
SRP021940_embryo | 0 .00 RPM | 79 .28 RPM |
SRP021940_placental_villous | 0 .00 RPM | 264 .18 RPM |
SRP021940_synovial_membrane | 0 .00 RPM | 56 .99 RPM |
SRP021940_testis | 0 .00 RPM | 147 .96 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000017959 | 1 retrocopy | |
Bos taurus | ENSBTAG00000008648 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000018014 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000004647 | 1 retrocopy | |
Equus caballus | ENSECAG00000017747 | 2 retrocopies |
retro_ecab_823, retro_ecab_844 ,
|
Echinops telfairi | ENSETEG00000000264 | 3 retrocopies | |
Felis catus | ENSFCAG00000028856 | 3 retrocopies | |
Homo sapiens | ENSG00000126432 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000001337 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000025661 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000013397 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000012907 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000005003 | 2 retrocopies | |
Procavia capensis | ENSPCAG00000010811 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000003106 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000003835 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000013030 | 2 retrocopies |