RetrogeneDB ID: | retro_nleu_2228 | ||
Retrocopy location | Organism: | Gibbon (Nomascus leucogenys) | |
| Coordinates: | GL397335.1:9607916..9608175(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PRDX5 | ||
| Ensembl ID: | ENSNLEG00000005003 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 57.3 % |
| Parental protein coverage: | 55.41 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | VNDAFVTGEWGRAH-KAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLK-RFSMVVQDGIVKSLNV |
| V....VTGEW..A.....GKV.L.ADPTGAFGK..DLLLDD.L...FGN..LK..FSMV..D..VK.LN. | |
| Retrocopy | VSTVSVTGEWQGAP<NTKGKVQLPADPTGAFGKQSDLLLDDLLLLLFGN*WLK<EFSMVMEDSVVKALNM |
| Parental | EPDGTGLTCSLAPNIISQL |
| .P..T..TC...PNII.QL | |
| Retrocopy | *PNCTDFTCRPGPNIILQL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017959 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000008648 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000018014 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000004647 | 1 retrocopy | |
| Equus caballus | ENSECAG00000017747 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000000264 | 3 retrocopies | |
| Felis catus | ENSFCAG00000028856 | 3 retrocopies | |
| Homo sapiens | ENSG00000126432 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000001337 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000025661 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000013397 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000012907 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000005003 | 2 retrocopies |
retro_nleu_1007, retro_nleu_2228 ,
|
| Procavia capensis | ENSPCAG00000010811 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000003106 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000003835 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000013030 | 2 retrocopies |