RetrogeneDB ID: | retro_fcat_751 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | B2:34237550..34237778(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSFCAG00000026097 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 68.42 % |
| Parental protein coverage: | 70.37 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVG |
| MGVQ.ETISPG.G.T..K.GQT.VV.Y...LEDGKK..SS.DRN.P..FMLG..EVIRGWEE..AQ.SVG | |
| Retrocopy | MGVQEETISPGGG*TLSKHGQTYVVYYPVILEDGKKLYSSQDRNNPLTFMLGM*EVIRGWEERIAQVSVG |
| Parental | QRAKLT |
| QR.KL. | |
| Retrocopy | QRVKLS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .11 RPM | 324 .00 RPM |
| SRP017611_kidney | 0 .00 RPM | 126 .86 RPM |
| SRP017611_liver | 0 .10 RPM | 37 .30 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000008303 | 4 retrocopies | |
| Ciona savignyi | ENSCSAVG00000006859 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000007454 | 1 retrocopy | |
| Felis catus | ENSFCAG00000026097 | 2 retrocopies |
retro_fcat_168, retro_fcat_751 ,
|
| Felis catus | ENSFCAG00000027304 | 1 retrocopy | |
| Homo sapiens | ENSG00000088832 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000001729 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000015996 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000019554 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000017946 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000013840 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000007188 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000003547 | 3 retrocopies | |
| Vicugna pacos | ENSVPAG00000011511 | 1 retrocopy |