RetrogeneDB ID: | retro_etel_2059 | ||
Retrocopy location | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | scaffold_44045:3995..4184(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSETEG00000018527 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSETEG00000007454 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 92.06 % |
| Parental protein coverage: | 58.33 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEG |
| MGVQVETISPGDGRTFPK.GQTCVVHY.GMLEDGKKFDSS.DRNKPFKFML.KQEVIRGW.EG | |
| Retrocopy | MGVQVETISPGDGRTFPKCGQTCVVHYKGMLEDGKKFDSSGDRNKPFKFMLFKQEVIRGWKEG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000008303 | 4 retrocopies | |
| Ciona savignyi | ENSCSAVG00000006859 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000003358 | 8 retrocopies | |
| Echinops telfairi | ENSETEG00000007454 | 1 retrocopy |
retro_etel_2059 ,
|
| Echinops telfairi | ENSETEG00000018432 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000018990 | 2 retrocopies | |
| Felis catus | ENSFCAG00000026097 | 2 retrocopies | |
| Homo sapiens | ENSG00000088832 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000001729 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000015996 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000019554 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000017946 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000013840 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000007188 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000003547 | 3 retrocopies | |
| Vicugna pacos | ENSVPAG00000011511 | 1 retrocopy |