RetrogeneDB ID: | retro_ggal_15 | ||
Retrocopylocation | Organism: | Chicken (Gallus gallus) | |
Coordinates: | 2:76684717..76685008(+) | ||
Located in intron of: | ENSGALG00000012997 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C12orf45 | ||
Ensembl ID: | ENSGALG00000012694 | ||
Aliases: | C12ORF45, C1H12orf45 | ||
Description: | chromosome 12 open reading frame 45 [Source:HGNC Symbol;Acc:28628] |
Percent Identity: | 77.55 % |
Parental protein coverage: | 57.31 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MAGVGQAAGPAASRELLAAGRRGGLEETLLISPKPSSKKATTLQTVRMPRSNVLDRVQSFLPQMAHANDE |
..G.....G...S.........GGLEETLLIS.KPSSKKATTLQTVRMPRSNVLDRVQSFLPQMAHANDE | |
Retrocopy | LVGIFKITGYLISQTIMSTSY-GGLEETLLISSKPSSKKATTLQTVRMPRSNVLDRVQSFLPQMAHANDE |
Parental | LRRKMVTAPAHQFDIENLSSATEKVIEM |
LRRKM.T.PAHQFDIENLSSATEKVIEM | |
Retrocopy | LRRKMLTEPAHQFDIENLSSATEKVIEM |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 2 .50 RPM |
SRP007412_cerebellum | 0 .00 RPM | 1 .23 RPM |
SRP007412_heart | 0 .00 RPM | 0 .64 RPM |
SRP007412_kidney | 0 .00 RPM | 1 .24 RPM |
SRP007412_liver | 0 .00 RPM | 1 .45 RPM |
SRP007412_testis | 0 .03 RPM | 1 .91 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000014728 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000017235 | 1 retrocopy | |
Homo sapiens | ENSG00000151131 | 1 retrocopy | |
Gallus gallus | ENSGALG00000012694 | 1 retrocopy |
retro_ggal_15 ,
|
Gorilla gorilla | ENSGGOG00000027272 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000017133 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000006584 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000004897 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000005381 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000027792 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000005714 | 1 retrocopy |