RetrogeneDB ID: | retro_ggal_15 | ||
Retrocopy location | Organism: | Chicken (Gallus gallus) | |
| Coordinates: | 2:76684717..76685008(+) | ||
| Located in intron of: | ENSGALG00000012997 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | C12orf45 | ||
| Ensembl ID: | ENSGALG00000012694 | ||
| Aliases: | C12ORF45, C1H12orf45 | ||
| Description: | chromosome 12 open reading frame 45 [Source:HGNC Symbol;Acc:28628] |
| Percent Identity: | 77.55 % |
| Parental protein coverage: | 57.31 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MAGVGQAAGPAASRELLAAGRRGGLEETLLISPKPSSKKATTLQTVRMPRSNVLDRVQSFLPQMAHANDE |
| ..G.....G...S.........GGLEETLLIS.KPSSKKATTLQTVRMPRSNVLDRVQSFLPQMAHANDE | |
| Retrocopy | LVGIFKITGYLISQTIMSTSY-GGLEETLLISSKPSSKKATTLQTVRMPRSNVLDRVQSFLPQMAHANDE |
| Parental | LRRKMVTAPAHQFDIENLSSATEKVIEM |
| LRRKM.T.PAHQFDIENLSSATEKVIEM | |
| Retrocopy | LRRKMLTEPAHQFDIENLSSATEKVIEM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 2 .50 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 1 .23 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .64 RPM |
| SRP007412_kidney | 0 .00 RPM | 1 .24 RPM |
| SRP007412_liver | 0 .00 RPM | 1 .45 RPM |
| SRP007412_testis | 0 .03 RPM | 1 .91 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000014728 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000017235 | 1 retrocopy | |
| Homo sapiens | ENSG00000151131 | 1 retrocopy | |
| Gallus gallus | ENSGALG00000012694 | 1 retrocopy |
retro_ggal_15 ,
|
| Gorilla gorilla | ENSGGOG00000027272 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000017133 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000006584 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000004897 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000005381 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000027792 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000005714 | 1 retrocopy |