RetrogeneDB ID: | retro_ggor_674 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 11:111605336..111605630(+) | ||
| Located in intron of: | ENSGGOG00000015283 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | COX7A2L | ||
| Ensembl ID: | ENSGGOG00000010739 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 77.55 % |
| Parental protein coverage: | 85.96 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | YYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKAD |
| YYKFSGFT..L.GAW.SEAYSP.GL.PVVSTEAPPIIFA.PTKLTSDST.Y..A.KNKVPELQKF.QKAD | |
| Retrocopy | YYKFSGFTFELVGAWTSEAYSP*GLMPVVSTEAPPIIFAIPTKLTSDSTAYNFARKNKVPELQKFLQKAD |
| Parental | GVPVYLKRGLPDQMLYRTTMALTVGGTI |
| .VP..L..G.PDQMLY.TTM.LTVGG.. | |
| Retrocopy | DVPIHLI*GFPDQMLYWTTMVLTVGGIL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 67 .33 RPM |
| SRP007412_cerebellum | 0 .04 RPM | 39 .75 RPM |
| SRP007412_heart | 0 .03 RPM | 19 .70 RPM |
| SRP007412_kidney | 0 .04 RPM | 58 .23 RPM |
| SRP007412_liver | 0 .03 RPM | 44 .76 RPM |
| SRP007412_testis | 0 .00 RPM | 54 .08 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_825 |
| Pan troglodytes | retro_ptro_575 |
| Pongo abelii | retro_pabe_737 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Echinops telfairi | ENSETEG00000011940 | 1 retrocopy | |
| Homo sapiens | ENSG00000115944 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000005865 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000010739 | 1 retrocopy |
retro_ggor_674 ,
|
| Macaca mulatta | ENSMMUG00000016278 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000008875 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000024248 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000016666 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000027189 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000016029 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000011865 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000012922 | 1 retrocopy |