RetrogeneDB ID: | retro_mdom_1202 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 3:466421113..466421437(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMODG00000002661 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 87.96 % |
| Parental protein coverage: | 51.18 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | ETQKMSWSKPRNVQILNMVTRQGALWANTLGSLALLYSAFGVVIEKTRGAEDDINTVAAGTMTGMLYKCT |
| ETQKMSWSKPRN.QILNM.TRQGALWANTL.SL.LLYSAFGVVI.KT.GAEDDINT.AAGTM.G.L.KCT | |
| Retrocopy | ETQKMSWSKPRNEQILNMITRQGALWANTLVSLVLLYSAFGVVIDKT*GAEDDINTGAAGTMAGIL*KCT |
| Parental | GGLRGVARGGLTGLTLTSLYALYNNWEHMKGSMTQQSL |
| GGLRGVA..GLTGLTLTSLYALYNNWEHMKGSM.QQSL | |
| Retrocopy | GGLRGVAGRGLTGLTLTSLYALYNNWEHMKGSMAQQSL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 215 .15 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 243 .21 RPM |
| SRP007412_heart | 0 .00 RPM | 328 .13 RPM |
| SRP007412_kidney | 0 .00 RPM | 341 .06 RPM |
| SRP007412_liver | 0 .00 RPM | 328 .78 RPM |
| SRP007412_testis | 0 .00 RPM | 478 .12 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000007501 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000029477 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000007073 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000013336 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000019917 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000002661 | 2 retrocopies |
retro_mdom_1202 , retro_mdom_860,
|
| Mus musculus | ENSMUSG00000013701 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000000525 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000015393 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000005255 | 2 retrocopies | |
| Procavia capensis | ENSPCAG00000015914 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000019811 | 3 retrocopies | |
| Sorex araneus | ENSSARG00000010335 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000025276 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000007041 | 1 retrocopy |