RetrogeneDB ID: | retro_mmul_2125 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 7:5878018..5878386(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MMU.2525 | ||
Ensembl ID: | ENSMMUG00000019203 | ||
Aliases: | TVP23B, FAM18B, FAM18B1 | ||
Description: | None |
Percent Identity: | 70.87 % |
Parental protein coverage: | 67.74 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MLQQDSNDDTEDVSLFDAEEETTNRPRKSKIRHPVASFFHLFFRVSAIVVYLLCELLSSSFITCMVTIIL |
ML.QDSNDDTED.S..DAEE.TTN....SKIR.P.AS.F.LFFRVSA.VV.LLC.L.SSSF..CMVTII. | |
Retrocopy | MLHQDSNDDTEDISMLDAEE-TTNKTKQSKIRYPAASLFQLFFRVSAVVVSLLCKLVSSSFTACMVTII- |
Parental | LLSCDFWAVKNVTGRLMVGLRWWNHI-DEDGKSHWVFESRKESSQENKTVSEAESRI |
.LSCDF.AV.NVTG.L.VGL..WNH..DEDGKSHWV.ESRK..S.E..TVSEAES.. | |
Retrocopy | -LSCDFRAVMNVTGGLVVGLWCWNHV<DEDGKSHWVLESRKAYSREDETVSEAESNL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 21 .51 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 15 .39 RPM |
SRP007412_cerebellum | 0 .00 RPM | 26 .93 RPM |
SRP007412_heart | 0 .00 RPM | 14 .31 RPM |
SRP007412_kidney | 0 .00 RPM | 20 .77 RPM |
SRP007412_liver | 0 .00 RPM | 12 .23 RPM |
SRP007412_testis | 0 .00 RPM | 22 .39 RPM |
Species | RetrogeneDB ID |
---|---|
Pan troglodytes | retro_ptro_996 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Cavia porcellus | ENSCPOG00000005330 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000007609 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000003854 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000015098 | 4 retrocopies | |
Myotis lucifugus | ENSMLUG00000002825 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000019203 | 5 retrocopies | |
Nomascus leucogenys | ENSNLEG00000014658 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000000498 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000012225 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000050649 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000000642 | 6 retrocopies | |
Tarsius syrichta | ENSTSYG00000008082 | 2 retrocopies |