RetrogeneDB ID: | retro_mmul_2369 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 8:121502691..121503043(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MMU.4321 | ||
Ensembl ID: | ENSMMUG00000005759 | ||
Aliases: | None | ||
Description: | gamma-aminobutyric acid receptor-associated protein-like 2 [Source:RefSeq peptide;Acc:NP_001181193] |
Percent Identity: | 71.67 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 5 |
Number of frameshifts detected | 2 |
Parental | MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQL |
.K.MFKE.HSLEHRC.ES.KI.A.YPD.V.VIVEKVSGSQ.V..D....L.P.D.TVAQ...IIRKRIQL | |
Retrocopy | IK*MFKEEHSLEHRCIESSKI*AIYPDQVLVIVEKVSGSQVVNTDNQRKLGPVDATVAQLI*IIRKRIQL |
Parental | PSEKAIFLFVDKTVPQSSLTMGQL-YEKEKDEDGFLYV-AYSGENT-FGF |
PSEK.IFLFV.KTVP.SSLTMGQL...KEKDED.FLYV.AYS..N..FGF | |
Retrocopy | PSEKEIFLFVNKTVP*SSLTMGQL<FQKEKDED*FLYVLAYSIWNI<FGF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 84 .71 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 90 .59 RPM |
SRP007412_cerebellum | 0 .00 RPM | 106 .35 RPM |
SRP007412_heart | 0 .24 RPM | 58 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 50 .82 RPM |
SRP007412_liver | 0 .00 RPM | 22 .17 RPM |
SRP007412_testis | 0 .04 RPM | 26 .05 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_4115 |
Pan troglodytes | retro_ptro_2794 |
Pongo abelii | retro_pabe_3368 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000005453 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000014253 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000002240 | 2 retrocopies | |
Homo sapiens | ENSG00000034713 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000012299 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000017065 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000015112 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000002197 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000005759 | 2 retrocopies |
retro_mmul_2369 , retro_mmul_540,
|
Macaca mulatta | ENSMMUG00000010545 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000017613 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000013048 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000007565 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000008362 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000019425 | 1 retrocopy |