RetrogeneDB ID: | retro_dnov_1755 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_288342:174..524(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | GABARAPL2 | ||
Ensembl ID: | ENSDNOG00000002240 | ||
Aliases: | None | ||
Description: | GABA(A) receptor-associated protein-like 2 [Source:HGNC Symbol;Acc:13291] |
Percent Identity: | 66.1 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | MKWMFKEDHS-LEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQ |
.K..FKE.HS..EHRCVES.K...KYP....V.V.K.SGS.IVD.DK.K.LVP.D.T.AQFMW.IR.R.Q | |
Retrocopy | LK*IFKEEHS<TEHRCVESMKVQVKYPNQFLVMVGKLSGSPIVDTDKQKCLVPPDLTAAQFMWVIRTRLQ |
Parental | LPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGV |
LPS..AIFLFVDKTVP..SLTMGQ.Y.KEKD.DGF.Y.A.S..NTFG. | |
Retrocopy | LPSGRAIFLFVDKTVPEPSLTMGQPYKKEKDKDGFFYIAHSR*NTFGI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 35 .39 RPM |
SRP012922_cerebellum | 0 .00 RPM | 99 .80 RPM |
SRP012922_heart | 0 .00 RPM | 48 .96 RPM |
SRP012922_kidney | 0 .00 RPM | 65 .98 RPM |
SRP012922_liver | 0 .00 RPM | 27 .25 RPM |
SRP012922_lung | 0 .00 RPM | 73 .00 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 90 .18 RPM |
SRP012922_spleen | 0 .00 RPM | 100 .15 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000005453 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000031455 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000014253 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000002240 | 2 retrocopies |
retro_dnov_1755 , retro_dnov_2332,
|
Dasypus novemcinctus | ENSDNOG00000010228 | 7 retrocopies | |
Erinaceus europaeus | ENSEEUG00000011134 | 1 retrocopy | |
Homo sapiens | ENSG00000034713 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000012299 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000017065 | 2 retrocopies | |
Microcebus murinus | ENSMICG00000011981 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000015112 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000005759 | 2 retrocopies | |
Mustela putorius furo | ENSMPUG00000009894 | 1 retrocopy | |
Mus musculus | ENSMUSG00000031950 | 5 retrocopies | |
Nomascus leucogenys | ENSNLEG00000013048 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000007565 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000008362 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000019425 | 1 retrocopy |