RetrogeneDB ID: | retro_mmul_808 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 11:51721352..51721610(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RNF181 | ||
Ensembl ID: | ENSMMUG00000017824 | ||
Aliases: | None | ||
Description: | E3 ubiquitin-protein ligase RNF181 [Source:RefSeq peptide;Acc:NP_001252843] |
Percent Identity: | 64.84 % |
Parental protein coverage: | 57.52 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 3 |
Parental | VIRGSQAELKCPVCLLEFEEEETAIEMPCHHLFHSS-CILPWLSKTNS-CPLCRHELPTDDDTYEEHRRD |
...G..A.LKCP.CLL..EEE.T.IEMPCHHLFH.....LPWLSKTNS..PLC.HEL.TD.D..EEHR.D | |
Retrocopy | ISHGIPAQLKCPMCLLSLEEE-TDIEMPCHHLFHCN<LNLPWLSKTNS<LPLCCHELLTDNDM*EEHR*D |
Parental | KARKQQQ-QHRLENLHGAMYT |
.A.KQQQ....LE.LHGA.YT | |
Retrocopy | EAHKQQQ<EVWLEKLHGARYT |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 9 .86 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 14 .76 RPM |
SRP007412_cerebellum | 0 .00 RPM | 7 .43 RPM |
SRP007412_heart | 0 .00 RPM | 20 .79 RPM |
SRP007412_kidney | 0 .00 RPM | 26 .99 RPM |
SRP007412_liver | 0 .00 RPM | 24 .54 RPM |
SRP007412_testis | 0 .00 RPM | 44 .59 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1005 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000019647 | 3 retrocopies | |
Homo sapiens | ENSG00000168894 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000017824 | 3 retrocopies |
retro_mmul_1128, retro_mmul_1637, retro_mmul_808 ,
|
Pongo abelii | ENSPPYG00000012225 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000012138 | 2 retrocopies |