RetrogeneDB ID: | retro_mmus_526 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
Coordinates: | 10:10040922..10041234(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Rps9 | ||
Ensembl ID: | ENSMUSG00000006333 | ||
Aliases: | Rps9, 3010033P07Rik, AL022771, AL022885 | ||
Description: | ribosomal protein S9 [Source:MGI Symbol;Acc:MGI:1924096] |
Percent Identity: | 53.15 % |
Parental protein coverage: | 79.41 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 3 |
Parental | TYVTPRRPFE-KSRLDQELKLIGEYG-LRNKREVWRVKFTLAKIRKAARELLTLDEKDPRRLFEGNALLR |
TY....RP.E..SRL..ELKL....G...N..EV.R.KFT..K..KA..ELL.L.E......F..NAL.. | |
Retrocopy | TYMNSWRPLE<ESRLN*ELKLMKNVG<ILNNCEVCRIKFTSTKTCKAVQELLILGEI--QSIFKDNALVW |
Parental | RLVRIG-VLDEGKMKLDYILGLKIEDFLERRLQTQVFKLGL |
.L...G..LDEGKMKL.YILGLKI..FL...L.TQVFK.GL | |
Retrocopy | QLLPLG<ALDEGKMKLNYILGLKIKGFL-M*LHTQVFKTGL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .05 RPM | 67 .85 RPM |
SRP007412_cerebellum | 0 .00 RPM | 67 .52 RPM |
SRP007412_heart | 0 .00 RPM | 154 .03 RPM |
SRP007412_kidney | 0 .00 RPM | 120 .71 RPM |
SRP007412_liver | 0 .00 RPM | 120 .79 RPM |
SRP007412_testis | 0 .00 RPM | 68 .47 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Gorilla gorilla | ENSGGOG00000027839 | 4 retrocopies | |
Mustela putorius furo | ENSMPUG00000010394 | 1 retrocopy | |
Mus musculus | ENSMUSG00000006333 | 2 retrocopies |
retro_mmus_3082, retro_mmus_526 ,
|
Nomascus leucogenys | ENSNLEG00000006314 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000011449 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000011355 | 7 retrocopies | |
Rattus norvegicus | ENSRNOG00000049813 | 3 retrocopies |