RetrogeneDB ID: | retro_mmus_931 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 12:51710408..51710594(-) | ||
| Located in intron of: | ENSMUSG00000020955 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Lsm2 | ||
| Ensembl ID: | ENSMUSG00000007050 | ||
| Aliases: | Lsm2, D17H6S56E-2, D17H6S56E2, Dmapl, Dmpkap, G7b, Sm-X5, SmX5, snRNP | ||
| Description: | LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:90676] |
| Percent Identity: | 77.42 % |
| Parental protein coverage: | 65.26 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFI |
| MLF.SF.KS.V.K.VV.E.KNDLSICGTLHSV..YL.IKL.DIS.TDPEKY.HMLSVKNCF. | |
| Retrocopy | MLFHSFLKSPVVKGVVMEPKNDLSICGTLHSVE*YLKIKLADISTTDPEKYLHMLSVKNCFV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .02 RPM | 6 .59 RPM |
| SRP007412_cerebellum | 0 .09 RPM | 9 .12 RPM |
| SRP007412_heart | 0 .00 RPM | 6 .79 RPM |
| SRP007412_kidney | 0 .00 RPM | 7 .08 RPM |
| SRP007412_liver | 0 .00 RPM | 9 .48 RPM |
| SRP007412_testis | 0 .00 RPM | 99 .35 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000002601 | 2 retrocopies | |
| Felis catus | ENSFCAG00000004511 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000006832 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000007050 | 1 retrocopy |
retro_mmus_931 ,
|
| Nomascus leucogenys | ENSNLEG00000006371 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000003668 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000016461 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000017986 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000048725 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000013144 | 1 retrocopy |