RetrogeneDB ID: | retro_opri_250 | ||
Retrocopylocation | Organism: | Southern American pika (Ochotona princeps) | |
Coordinates: | GeneScaffold_4227:450475..450637(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | LSM2 | ||
Ensembl ID: | ENSOPRG00000003668 | ||
Aliases: | None | ||
Description: | LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) [Source:HGNC Symbol;Acc:13940] |
Percent Identity: | 72.73 % |
Parental protein coverage: | 57.89 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHML |
MLFYS.F..LV.KDVVVEL.NDL.ICGTLHSVDQYLNIKLTD........YPH.L | |
Retrocopy | MLFYSVFQALVSKDVVVELRNDLIICGTLHSVDQYLNIKLTD-TRSQALRYPHLL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000002601 | 2 retrocopies | |
Felis catus | ENSFCAG00000004511 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000006832 | 3 retrocopies | |
Mus musculus | ENSMUSG00000007050 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000006371 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000003668 | 2 retrocopies |
retro_opri_250 , retro_opri_917,
|
Pongo abelii | ENSPPYG00000016461 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000017986 | 3 retrocopies | |
Rattus norvegicus | ENSRNOG00000048725 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000013144 | 1 retrocopy |