RetrogeneDB ID: | retro_ocun_1404 | ||
Retrocopylocation | Organism: | Rabbit (Oryctolagus cuniculus) | |
Coordinates: | 8:28909939..28910162(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ARL8A | ||
Ensembl ID: | ENSOCUG00000023009 | ||
Aliases: | None | ||
Description: | ADP-ribosylation factor-like 8A [Source:HGNC Symbol;Acc:25192] |
Percent Identity: | 70.13 % |
Parental protein coverage: | 59.06 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | IPTVGFNMRKITK-GNVTIKLWDIG-GQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDK |
IP.VGFN.RK.T..GNVTIK..D.G.GQPRF...WE.Y.RGVSA.VY..DAA..EKIEAS.NEL.NLLDK | |
Retrocopy | IPWVGFNTRKVTQ<GNVTIKTRDVG<GQPRFWNTWE*YRRGVSAMVYVIDAAKLEKIEASPNELYNLLDK |
Parental | PQLQGIP |
PQ.QG.P | |
Retrocopy | PQEQGTP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 31 .02 RPM |
SRP017611_kidney | 0 .00 RPM | 3 .55 RPM |
SRP017611_liver | 0 .00 RPM | 0 .77 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Meleagris gallopavo | ENSMGAG00000001081 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000000824 | 4 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000014090 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000023009 | 1 retrocopy |
retro_ocun_1404 ,
|
Oryctolagus cuniculus | ENSOCUG00000023198 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000023645 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000013990 | 1 retrocopy |