RetrogeneDB ID: | retro_ogar_1224 | ||
Retrocopy location | Organism: | Bushbaby (Otolemur garnettii) | |
| Coordinates: | GL873539.1:5704868..5705078(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | GABARAP | ||
| Ensembl ID: | ENSOGAG00000004388 | ||
| Aliases: | None | ||
| Description: | GABA(A) receptor-associated protein [Source:HGNC Symbol;Acc:4067] |
| Percent Identity: | 98.57 % |
| Parental protein coverage: | 59.83 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL |
| MKFVYKEEHPFEKRRSEGEKIRKKYPD.VPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL | |
| Retrocopy | MKFVYKEEHPFEKRRSEGEKIRKKYPDWVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ciona intestinalis | ENSCING00000012473 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000004652 | 7 retrocopies | |
| Loxodonta africana | ENSLAFG00000000744 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000010545 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000010473 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000004256 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000004388 | 2 retrocopies |
retro_ogar_1212, retro_ogar_1224 ,
|
| Sus scrofa | ENSSSCG00000017936 | 1 retrocopy | |
| Drosophila melanogaster | FBgn0052672 | 1 retrocopy |