RetrogeneDB ID: | retro_pabe_2031 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 2a_random:2389429..2389654(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSPPYG00000009694 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 86.67 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MIGDILLFGTLLMNAGAVLNFKLKKKDTQGFGEESREPSTGDNIREFLLSLRYFRIFIALWNIFMMFCMI |
MIGDILLFGTLL.NAGAVLNFKLKKKD.QGFG.E..EPSTGDNIREFLLSLRYF.IF..LWNIF.M.CMI | |
Retrocopy | MIGDILLFGTLLINAGAVLNFKLKKKDMQGFGKEAWEPSTGDNIREFLLSLRYF*IFTILWNIFIMCCMI |
Parental | VLFGS |
VLFGS | |
Retrocopy | VLFGS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 22 .28 RPM |
SRP007412_cerebellum | 0 .00 RPM | 8 .03 RPM |
SRP007412_heart | 0 .00 RPM | 6 .83 RPM |
SRP007412_kidney | 0 .00 RPM | 23 .27 RPM |
SRP007412_liver | 0 .00 RPM | 17 .17 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000010105 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000015643 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000013936 | 1 retrocopy | |
Equus caballus | ENSECAG00000026861 | 1 retrocopy | |
Felis catus | ENSFCAG00000016411 | 1 retrocopy | |
Homo sapiens | ENSG00000214046 | 1 retrocopy | |
Mus musculus | ENSMUSG00000044600 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000005569 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000009694 | 2 retrocopies |
retro_pabe_1964, retro_pabe_2031 ,
|
Pan troglodytes | ENSPTRG00000010650 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000042037 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000013863 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000009556 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000015020 | 2 retrocopies | |
Vicugna pacos | ENSVPAG00000006699 | 1 retrocopy |