RetrogeneDB ID: | retro_rnor_2694 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 9:71431882..71432107(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Smim7 | ||
| Ensembl ID: | ENSRNOG00000042037 | ||
| Aliases: | None | ||
| Description: | UPF0608 protein C19orf42 homolog [Source:UniProtKB/Swiss-Prot;Acc:B0BN70] |
| Percent Identity: | 77.33 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MIGDILLFGTLLMNAGAVLNFKLKKKDTQGFGEESREPSTGDNIREFLLSLRYFRIFIALWNVFMMLCMI |
| M.GDILLFG..LMNA.AVLNFKLKKKD.Q.FGEE.REPSTG.N.REFL.SLR.FR.FIALWN.FM.LC.I | |
| Retrocopy | MMGDILLFGRSLMNARAVLNFKLKKKDKQDFGEELREPSTGNNSREFLVSLRNFRVFIALWNGFMILCTI |
| Parental | VLFGS |
| .LF.S | |
| Retrocopy | ELFSS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 41 .12 RPM |
| SRP017611_kidney | 0 .00 RPM | 39 .08 RPM |
| SRP017611_liver | 0 .00 RPM | 20 .04 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Mus musculus | retro_mmus_450 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000010105 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000015643 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000013936 | 1 retrocopy | |
| Equus caballus | ENSECAG00000026861 | 1 retrocopy | |
| Felis catus | ENSFCAG00000016411 | 1 retrocopy | |
| Homo sapiens | ENSG00000214046 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000044600 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000005569 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000009694 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000010650 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000042037 | 1 retrocopy |
retro_rnor_2694 ,
|
| Sus scrofa | ENSSSCG00000013863 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000009556 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000015020 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000006699 | 1 retrocopy |