RetrogeneDB ID: | retro_ptro_1589 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 2A:35703043..35703259(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSPTRG00000010650 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 84.72 % |
Parental protein coverage: | 69.9 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MIGDILLFGTLLMNAGAVLNFKLKKKDTQGFGEESREPSTGDNIREFLLSLRYFRIFIALWNIFMMFCMI |
MIGDILLFGTLLMNAGAVLNFKLKKKD.QGFG.E..EPSTGDN.REFLLSLRYF.IF..LWN.F.M.CMI | |
Retrocopy | MIGDILLFGTLLMNAGAVLNFKLKKKDMQGFGKEAWEPSTGDNTREFLLSLRYF*IFTSLWNVFIMCCMI |
Parental | VL |
VL | |
Retrocopy | VL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 9 .65 RPM |
SRP007412_cerebellum | 0 .00 RPM | 13 .41 RPM |
SRP007412_heart | 0 .00 RPM | 11 .28 RPM |
SRP007412_kidney | 0 .00 RPM | 18 .52 RPM |
SRP007412_liver | 0 .00 RPM | 24 .06 RPM |
SRP007412_testis | 0 .00 RPM | 28 .88 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2244 |
Pongo abelii | retro_pabe_1964 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000010105 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000015643 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000013936 | 1 retrocopy | |
Equus caballus | ENSECAG00000026861 | 1 retrocopy | |
Felis catus | ENSFCAG00000016411 | 1 retrocopy | |
Homo sapiens | ENSG00000214046 | 1 retrocopy | |
Mus musculus | ENSMUSG00000044600 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000005569 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000009694 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000010650 | 1 retrocopy |
retro_ptro_1589 ,
|
Rattus norvegicus | ENSRNOG00000042037 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000013863 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000009556 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000015020 | 2 retrocopies | |
Vicugna pacos | ENSVPAG00000006699 | 1 retrocopy |