RetrogeneDB ID: | retro_pabe_2504 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 4:10038151..10038394(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | HRSP12 | ||
Ensembl ID: | ENSPPYG00000018776 | ||
Aliases: | None | ||
Description: | heat-responsive protein 12 [Source:HGNC Symbol;Acc:16897] |
Percent Identity: | 66.67 % |
Parental protein coverage: | 59.12 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGGVAEEAKQALKNMGEILKAAG |
MSSLI..VI.TAKAP...GPY.Q.VLV.RTI.ISGQ..MD.S..QLV.G....EAKQAL..MGE.LK.AG | |
Retrocopy | MSSLIKKVIRTAKAPRVLGPYGQGVLVNRTIHISGQLIMDSSNAQLVAGEIPKEAKQALTKMGEVLKTAG |
Parental | CDFTNVVKTTV |
CDFTNVV...V | |
Retrocopy | CDFTNVVNNFV |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .06 RPM | 19 .52 RPM |
SRP007412_cerebellum | 0 .12 RPM | 16 .66 RPM |
SRP007412_heart | 0 .00 RPM | 3 .01 RPM |
SRP007412_kidney | 0 .07 RPM | 161 .29 RPM |
SRP007412_liver | 0 .00 RPM | 155 .55 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3022 |
Pan troglodytes | retro_ptro_2040 |