RetrogeneDB ID: | retro_ptro_1166 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 17:21445606..21445851(+) | ||
| Located in intron of: | ENSPTRG00000030902 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TOMM20 | ||
| Ensembl ID: | ENSPTRG00000002127 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 75.9 % |
| Parental protein coverage: | 55.86 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | RNSAIAAGVCGALFIGYCIYFDRKRR-SDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLE |
| RN.AIAAGV.GALFIGYCIYFDRKR..SDPN.KNR..E.RKKQKLA.E...LSKL.DLKDAEAVQKF.LE | |
| Retrocopy | RNGAIAAGVFGALFIGYCIYFDRKRL>SDPNLKNRRPE*RKKQKLAEE*VELSKLADLKDAEAVQKFLLE |
| Parental | EI-QLGEELLAQG |
| EI....EE.LA.G | |
| Retrocopy | EI>SFSEEILAKG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .07 RPM | 200 .62 RPM |
| SRP007412_cerebellum | 0 .07 RPM | 195 .41 RPM |
| SRP007412_heart | 0 .09 RPM | 92 .36 RPM |
| SRP007412_kidney | 0 .03 RPM | 111 .80 RPM |
| SRP007412_liver | 0 .03 RPM | 75 .29 RPM |
| SRP007412_testis | 0 .11 RPM | 41 .63 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1827 |
| Macaca mulatta | retro_mmul_1255 |