RetrogeneDB ID: | retro_ptro_3105 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | X:38839736..38840135(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | BAG1 | ||
| Ensembl ID: | ENSPTRG00000020856 | ||
| Aliases: | None | ||
| Description: | BCL2-associated athanogene [Source:HGNC Symbol;Acc:937] |
| Percent Identity: | 78.95 % |
| Parental protein coverage: | 54.96 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | EVIGVPQSFQKLIFKGKSLKEMETPLSALGIQDGCRVMLIGKKNSPQEEVELKKLKHLEKSVEKIADQLE |
| E..GVP.SFQKLIFKG.SLKEME.PLSA.GIQ.GC.VMLIGKKNSP.EEVEL.KLK.L.K.VEK.AD.L. | |
| Retrocopy | EATGVPLSFQKLIFKGTSLKEMEIPLSACGIQNGCQVMLIGKKNSPEEEVELEKLKDLVKPVEKKADEL* |
| Parental | ELNKELTGIQQGFLPKDLQADALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGL |
| ELNK.LTG.QQGFL.KDL...ALCKLDRR.KAT..QFMKILEEIDTLILPENFKD.R.K.KGL | |
| Retrocopy | ELNKQLTGLQQGFLAKDLPTEALCKLDRRGKATTKQFMKILEEIDTLILPENFKDNRSKKKGL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 1 .38 RPM | 33 .53 RPM |
| SRP007412_cerebellum | 0 .04 RPM | 44 .49 RPM |
| SRP007412_heart | 0 .00 RPM | 35 .47 RPM |
| SRP007412_kidney | 0 .00 RPM | 46 .84 RPM |
| SRP007412_liver | 0 .00 RPM | 43 .01 RPM |
| SRP007412_testis | 0 .00 RPM | 210 .03 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_4673 |
| Gorilla gorilla | retro_ggor_2899 |
| Pongo abelii | retro_pabe_3630 |
| Macaca mulatta | retro_mmul_2487 |
| Callithrix jacchus | retro_cjac_4052 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000017845 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000012656 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000008074 | 1 retrocopy | |
| Equus caballus | ENSECAG00000017942 | 1 retrocopy | |
| Homo sapiens | ENSG00000107262 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000016534 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000020148 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000005204 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000008945 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000019138 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000020856 | 1 retrocopy |
retro_ptro_3105 ,
|
| Tursiops truncatus | ENSTTRG00000010573 | 2 retrocopies |