RetrogeneDB ID: | retro_rnor_1606 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
Coordinates: | 2:43634317..43634610(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Ska2 | ||
Ensembl ID: | ENSRNOG00000025981 | ||
Aliases: | Ska2, Fam33a, RGD1307084 | ||
Description: | Spindle and kinetochore-associated protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q5I0J4] |
Percent Identity: | 51.96 % |
Parental protein coverage: | 70.14 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | SDLDYLQYRLEYEVKINHPHSAGEKNAVAILKELSAIKSRYQALCARFKTVSVEQKETKSCICAILNKTM |
.DLD....RLEY....NHP.S.GEKN...I.K.L.A.KS.YQ.L...FK.VSVEQ.E.K...CA.L..T. | |
Retrocopy | ADLDHIRHRLEYKINTNHPDSTGEKNPIKI*KKLPAMKSQYQTLHTHFKPVSVEQREIKG*VCAVLSRTV |
Parental | TMLQELQKQTNLELTLL-TEEEKAVTERLKSH |
T.......QT.LELTLL..EE.KA.T...K.H | |
Retrocopy | THVR--TEQTDLELTLL<AEE-KAMTQQSKAH |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 2 .52 RPM |
SRP017611_kidney | 0 .00 RPM | 5 .44 RPM |
SRP017611_liver | 0 .00 RPM | 1 .01 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000021680 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000029233 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000006051 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000010768 | 2 retrocopies | |
Equus caballus | ENSECAG00000015007 | 1 retrocopy | |
Felis catus | ENSFCAG00000022802 | 1 retrocopy | |
Homo sapiens | ENSG00000182628 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000003405 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000010942 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000014619 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000015241 | 1 retrocopy | |
Mus musculus | ENSMUSG00000020492 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000026072 | 4 retrocopies | |
Rattus norvegicus | ENSRNOG00000025981 | 3 retrocopies |
retro_rnor_1606 , retro_rnor_523, retro_rnor_733,
|
Sorex araneus | ENSSARG00000011128 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000024169 | 4 retrocopies | |
Tarsius syrichta | ENSTSYG00000006158 | 3 retrocopies | |
Tursiops truncatus | ENSTTRG00000017196 | 1 retrocopy |