RetrogeneDB ID: | retro_rnor_1721 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 20:16309172..16309412(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Erh | ||
| Ensembl ID: | ENSRNOG00000004883 | ||
| Aliases: | None | ||
| Description: | enhancer of rudimentary homolog [Source:RefSeq peptide;Acc:NP_001102912] |
| Percent Identity: | 70.73 % |
| Parental protein coverage: | 67.21 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | RPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPY |
| RPE.RTYAD.ESVN..MEGVC...E..LKRMNPNSPSI.Y....LF.FIDD.ADLSCLVY.ADTQT.QPY | |
| Retrocopy | RPESRTYAD*ESVNVGMEGVCRCMENNLKRMNPNSPSIPYEF--LFEFIDDRADLSCLVY*ADTQTCQPY |
| Parental | NKDWIKEKIYVL |
| N..W.KE...VL | |
| Retrocopy | NRGWVKENYEVL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 27 .39 RPM |
| SRP017611_kidney | 0 .00 RPM | 23 .17 RPM |
| SRP017611_liver | 0 .00 RPM | 10 .29 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000014529 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000014940 | 2 retrocopies | |
| Dipodomys ordii | ENSDORG00000006912 | 3 retrocopies | |
| Equus caballus | ENSECAG00000019178 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000014602 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000011879 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000021571 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000004636 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000029388 | 5 retrocopies | |
| Rattus norvegicus | ENSRNOG00000004883 | 3 retrocopies |
retro_rnor_1721 , retro_rnor_2670, retro_rnor_308,
|