RetrogeneDB ID: | retro_rnor_2800 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | X:48084732..48084996(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Srsf10 | ||
| Ensembl ID: | ENSRNOG00000007992 | ||
| Aliases: | Srsf10, Fusip1 | ||
| Description: | serine/arginine-rich splicing factor 10 [Source:RefSeq peptide;Acc:NP_001020909] |
| Percent Identity: | 67.03 % |
| Parental protein coverage: | 54.27 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 2 |
| Parental | ICGRQIEIQFAQGDRKTP-NQMKAKEGRNVYSSSRYDDYDRYRRSR-SRSYERRRSRSRSFDYNYRRSYS |
| ICG...EIQFA.G.RK.P.NQMKAK.GRNVYS...YDDYDRYR.SR.S.SYER...RS.SFDYNYR..YS | |
| Retrocopy | ICGHEMEIQFARGIRKPP>NQMKAK*GRNVYSFI*YDDYDRYRHSR<SQSYER*K-RSHSFDYNYRKPYS |
| Parental | PRNSRPTGRPRRSRSHSDNDR |
| P.NSR.TGR...S...SD..R | |
| Retrocopy | PGNSRLTGRTQLSQNDSDTNR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 18 .69 RPM |
| SRP017611_kidney | 0 .00 RPM | 22 .75 RPM |
| SRP017611_liver | 0 .00 RPM | 8 .74 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000009869 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000008072 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000004836 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000020883 | 9 retrocopies | |
| Cavia porcellus | ENSCPOG00000024533 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000008699 | 3 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000014286 | 1 retrocopy | |
| Homo sapiens | ENSG00000188529 | 5 retrocopies | |
| Gorilla gorilla | ENSGGOG00000000392 | 4 retrocopies | |
| Myotis lucifugus | ENSMLUG00000028520 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000015845 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000013180 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000029326 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000015374 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000001726 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000007992 | 3 retrocopies |
retro_rnor_1657, retro_rnor_2800 , retro_rnor_2829,
|
| Ictidomys tridecemlineatus | ENSSTOG00000000956 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000016150 | 2 retrocopies |