RetrogeneDB ID: | retro_rnor_2947 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
Coordinates: | X:78177317..78177576(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Selk | ||
Ensembl ID: | ENSRNOG00000014624 | ||
Aliases: | None | ||
Description: | Selenoprotein K [Source:UniProtKB/Swiss-Prot;Acc:P59798] |
Percent Identity: | 72.04 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | MVYISNGQVLDSRNQSPWRLSFITDFFWGIAEFVVFFFK-TLLQQDVKKRRGYGGSSDSRYDD-GRGPPG |
.VYISNGQVLDS.N.SPWRLSFITD.FWGIAEFV......TLLQQDVKKRR.Y..S.DSRYDD....P.. | |
Retrocopy | IVYISNGQVLDS*NKSPWRLSFITD-FWGIAEFVXXXLR<TLLQQDVKKRRSYESSYDSRYDD<QKPPGN |
Parental | NPPRRMGRISHLRGPSPPPMAGG |
.P.R.MG.ISH..GPSPPPMAGG | |
Retrocopy | TP*R-MGQISH--GPSPPPMAGG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 27 .25 RPM |
SRP017611_kidney | 0 .00 RPM | 19 .75 RPM |
SRP017611_liver | 0 .00 RPM | 15 .13 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000007612 | 8 retrocopies | |
Cavia porcellus | ENSCPOG00000007172 | 4 retrocopies | |
Homo sapiens | ENSG00000113811 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000000681 | 2 retrocopies | |
Microcebus murinus | ENSMICG00000017513 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000012622 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000019272 | 4 retrocopies | |
Mus musculus | ENSMUSG00000042682 | 9 retrocopies | |
Nomascus leucogenys | ENSNLEG00000026533 | 2 retrocopies | |
Ochotona princeps | ENSOPRG00000002266 | 6 retrocopies | |
Pongo abelii | ENSPPYG00000025894 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000015030 | 3 retrocopies | |
Pteropus vampyrus | ENSPVAG00000016291 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000014624 | 4 retrocopies | |
Sus scrofa | ENSSSCG00000011459 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000000506 | 2 retrocopies |