RetrogeneDB ID: | retro_ptro_1348 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 19:10455119..10455337(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SELK | ||
| Ensembl ID: | ENSPTRG00000015030 | ||
| Aliases: | None | ||
| Description: | Pan troglodytes selenoprotein K (SELK), mRNA. [Source:RefSeq mRNA;Acc:NM_001114877] |
| Percent Identity: | 68.92 % |
| Parental protein coverage: | 79.12 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | LSLITDFFWGIAEFVVLFF-KTLLQQDV-KKRRSYGNSSDSRYDDGRGPPGNPPRRMGRINHLRGPSPPP |
| LSLITDFFWGIA.FVVLFF.K.....DV......YGNSSDS.Y.DGR.PPGNP..RMG.IN.L.GPS.PP | |
| Retrocopy | LSLITDFFWGIA*FVVLFF>KLCFSKDV>XXXXGYGNSSDSSYGDGRQPPGNPAERMGQINNLSGPSSPP |
| Parental | MAGG |
| MA.G | |
| Retrocopy | MADG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .04 RPM | 19 .27 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 23 .70 RPM |
| SRP007412_heart | 0 .03 RPM | 31 .80 RPM |
| SRP007412_kidney | 0 .34 RPM | 26 .33 RPM |
| SRP007412_liver | 0 .00 RPM | 28 .05 RPM |
| SRP007412_testis | 0 .21 RPM | 46 .68 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2027 |
| Pongo abelii | retro_pabe_1658 |
| Macaca mulatta | retro_mmul_1388 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000007612 | 8 retrocopies | |
| Cavia porcellus | ENSCPOG00000007172 | 4 retrocopies | |
| Homo sapiens | ENSG00000113811 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000000681 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000017513 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000012622 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000019272 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000042682 | 9 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000026533 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000002266 | 6 retrocopies | |
| Pongo abelii | ENSPPYG00000025894 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000015030 | 3 retrocopies |
retro_ptro_1348 , retro_ptro_1370, retro_ptro_2386,
|
| Pteropus vampyrus | ENSPVAG00000016291 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000014624 | 4 retrocopies | |
| Sus scrofa | ENSSSCG00000011459 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000000506 | 2 retrocopies |