RetrogeneDB ID: | retro_pabe_2904 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 6:121097956..121098225(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SELK | ||
| Ensembl ID: | ENSPPYG00000025894 | ||
| Aliases: | None | ||
| Description: | selenoprotein K [Source:RefSeq peptide;Acc:NP_001186953] |
| Percent Identity: | 75.0 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MVYISNGQVLDSR-SQSPWRLSLITDFFWGIAEFVVLFFKTLLQQDVKKRRSYGNSSDSRYDDGRGPPGN |
| M.YI.NGQVLDSR.S.SPWRLSLITDFF...A.FV.LFFKTLLQQ.VKKR..YGN..DSRYD.GR.PPGN | |
| Retrocopy | MAYILNGQVLDSR<SPSPWRLSLITDFF*RTAKFVILFFKTLLQQHVKKR-GYGNTFDSRYDNGRRPPGN |
| Parental | PPRRMGRINHLHGPSPPPMAGG |
| P....G.INHLH.PSPPP.AGG | |
| Retrocopy | PLGETGQINHLHVPSPPPKAGG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 22 .84 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 28 .70 RPM |
| SRP007412_heart | 0 .00 RPM | 28 .96 RPM |
| SRP007412_kidney | 0 .00 RPM | 24 .66 RPM |
| SRP007412_liver | 0 .00 RPM | 56 .06 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3513 |
| Pan troglodytes | retro_ptro_2386 |
| Gorilla gorilla | retro_ggor_2375 |
| Macaca mulatta | retro_mmul_1861 |
| Callithrix jacchus | retro_cjac_2374 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000007612 | 8 retrocopies | |
| Cavia porcellus | ENSCPOG00000007172 | 4 retrocopies | |
| Homo sapiens | ENSG00000113811 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000000681 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000017513 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000012622 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000019272 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000042682 | 9 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000026533 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000002266 | 6 retrocopies | |
| Pongo abelii | ENSPPYG00000025894 | 3 retrocopies |
retro_pabe_107, retro_pabe_1658, retro_pabe_2904 ,
|
| Pan troglodytes | ENSPTRG00000015030 | 3 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000016291 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000014624 | 4 retrocopies | |
| Sus scrofa | ENSSSCG00000011459 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000000506 | 2 retrocopies |