RetrogeneDB ID: | retro_pabe_2904 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 6:121097956..121098225(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SELK | ||
Ensembl ID: | ENSPPYG00000025894 | ||
Aliases: | None | ||
Description: | selenoprotein K [Source:RefSeq peptide;Acc:NP_001186953] |
Percent Identity: | 75. % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | MVYISNGQVLDSR-SQSPWRLSLITDFFWGIAEFVVLFFKTLLQQDVKKRRSYGNSSDSRYDDGRGPPGN |
M.YI.NGQVLDSR.S.SPWRLSLITDFF...A.FV.LFFKTLLQQ.VKKR..YGN..DSRYD.GR.PPGN | |
Retrocopy | MAYILNGQVLDSR<SPSPWRLSLITDFF*RTAKFVILFFKTLLQQHVKKR-GYGNTFDSRYDNGRRPPGN |
Parental | PPRRMGRINHLHGPSPPPMAGG |
P....G.INHLH.PSPPP.AGG | |
Retrocopy | PLGETGQINHLHVPSPPPKAGG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 22 .84 RPM |
SRP007412_cerebellum | 0 .00 RPM | 28 .70 RPM |
SRP007412_heart | 0 .00 RPM | 28 .96 RPM |
SRP007412_kidney | 0 .00 RPM | 24 .66 RPM |
SRP007412_liver | 0 .00 RPM | 56 .06 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3513 |
Pan troglodytes | retro_ptro_2386 |
Gorilla gorilla | retro_ggor_2375 |
Macaca mulatta | retro_mmul_1861 |
Callithrix jacchus | retro_cjac_2374 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000007612 | 8 retrocopies | |
Cavia porcellus | ENSCPOG00000007172 | 4 retrocopies | |
Homo sapiens | ENSG00000113811 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000000681 | 2 retrocopies | |
Microcebus murinus | ENSMICG00000017513 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000012622 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000019272 | 4 retrocopies | |
Mus musculus | ENSMUSG00000042682 | 9 retrocopies | |
Nomascus leucogenys | ENSNLEG00000026533 | 2 retrocopies | |
Ochotona princeps | ENSOPRG00000002266 | 6 retrocopies | |
Pongo abelii | ENSPPYG00000025894 | 3 retrocopies |
retro_pabe_107, retro_pabe_1658, retro_pabe_2904 ,
|
Pan troglodytes | ENSPTRG00000015030 | 3 retrocopies | |
Pteropus vampyrus | ENSPVAG00000016291 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000014624 | 4 retrocopies | |
Sus scrofa | ENSSSCG00000011459 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000000506 | 2 retrocopies |