RetrogeneDB ID: | retro_sscr_1159 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | X:62672480..62672633(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SNRPE | ||
| Ensembl ID: | ENSSSCG00000023562 | ||
| Aliases: | SNRPE, Sm-E, SmE, snRNP-E | ||
| Description: | small nuclear ribonucleoprotein polypeptide E [Source:HGNC Symbol;Acc:11161] |
| Percent Identity: | 82.35 % |
| Parental protein coverage: | 55.43 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | GQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMN |
| GQGQKV.KVMVQPIN.IFRYLQNR..IQVWLYEQVNM..E.CII.F.EYMN | |
| Retrocopy | GQGQKVWKVMVQPINVIFRYLQNRFWIQVWLYEQVNMWTEDCIIDFSEYMN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 11 .41 RPM |
| SRP014902_testis | 0 .00 RPM | 46 .96 RPM |
| SRP018288_heart | 0 .00 RPM | 33 .13 RPM |
| SRP018288_kidney | 0 .00 RPM | 33 .39 RPM |
| SRP018288_liver | 0 .00 RPM | 32 .14 RPM |
| SRP018288_lung | 0 .00 RPM | 11 .71 RPM |
| SRP018856_adipose | 0 .00 RPM | 18 .56 RPM |
| SRP035408_brain | 0 .00 RPM | 30 .33 RPM |
| SRP035408_liver | 0 .00 RPM | 36 .61 RPM |