RetrogeneDB ID: | retro_sscr_606 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
Coordinates: | 18:10393073..10393273(-) | ||
Located in intron of: | ENSSSCG00000016504 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SNRPE | ||
Ensembl ID: | ENSSSCG00000023562 | ||
Aliases: | SNRPE, Sm-E, SmE, snRNP-E | ||
Description: | small nuclear ribonucleoprotein polypeptide E [Source:HGNC Symbol;Acc:11161] |
Percent Identity: | 79.41 % |
Parental protein coverage: | 72.83 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | LQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQ-LGRIMLKGDNITLLQSVS |
.Q.R.R.QVWLYEQVNMRIEG...GF.EYMNLVLDDAEEI.SKTKSRK..LGRIMLKGD.I.LL.SVS | |
Retrocopy | VQKRWRMQVWLYEQVNMRIEGGVAGFEEYMNLVLDDAEEIRSKTKSRKH<LGRIMLKGDSIPLLPSVS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP014902_placenta | 0 .00 RPM | 11 .41 RPM |
SRP014902_testis | 0 .00 RPM | 46 .96 RPM |
SRP018288_heart | 0 .00 RPM | 33 .13 RPM |
SRP018288_kidney | 0 .00 RPM | 33 .39 RPM |
SRP018288_liver | 0 .00 RPM | 32 .14 RPM |
SRP018288_lung | 0 .20 RPM | 11 .71 RPM |
SRP018856_adipose | 0 .00 RPM | 18 .56 RPM |
SRP035408_brain | 0 .00 RPM | 30 .33 RPM |
SRP035408_liver | 0 .00 RPM | 36 .61 RPM |