RetrogeneDB ID: | retro_vpac_166 | ||
Retrocopylocation | Organism: | Alpaca (Vicugna pacos) | |
Coordinates: | GeneScaffold_2320:1277482..1277717(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PIGP | ||
Ensembl ID: | ENSVPAG00000009781 | ||
Aliases: | None | ||
Description: | phosphatidylinositol glycan anchor biosynthesis, class P [Source:HGNC Symbol;Acc:3046] |
Percent Identity: | 56.96 % |
Parental protein coverage: | 66.96 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | RLSKATGKMVENSPSPL-PERAIYG-FVLFLSSRFGFILYLVWAFIPESWLNSLGLTYWPQKYWAVALPV |
R....T...VENSP....PERAI....VLFL.S..G..L....AFIP.SWLN.L.L..WPQKYWA.ALPV | |
Retrocopy | RMCQVTRTTVENSPLAV>PERAIHKRSVLFLTSHSGIML*CMQAFIPKSWLNYLVLNDWPQKYWAGALPV |
Parental | YLLITIVIG |
Y..I..VIG | |
Retrocopy | YFFIAVVIG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000009702 | 4 retrocopies | |
Myotis lucifugus | ENSMLUG00000005475 | 3 retrocopies | |
Monodelphis domestica | ENSMODG00000020988 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000008312 | 5 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000014284 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000001803 | 4 retrocopies | |
Tursiops truncatus | ENSTTRG00000007711 | 3 retrocopies | |
Vicugna pacos | ENSVPAG00000009781 | 3 retrocopies |
retro_vpac_166 , retro_vpac_387, retro_vpac_639,
|