RetrogeneDB ID: | retro_vpac_397 | ||
Retrocopylocation | Organism: | Alpaca (Vicugna pacos) | |
Coordinates: | scaffold_156697:146..362(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | LSM3 | ||
Ensembl ID: | ENSVPAG00000010709 | ||
Aliases: | None | ||
Description: | LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae) [Source:HGNC Symbol;Acc:17874] |
Percent Identity: | 76.39 % |
Parental protein coverage: | 75.79 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | VKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLR |
.K..NDREL.GRLHAYDQHLNM.LGD.E.TVTTIE.DEETYEEI.KS.K.NI.ML.V.GDGVVLV.P.LR | |
Retrocopy | MKTGNDRELQGRLHAYDQHLNMTLGDEEGTVTTIETDEETYEEIHKSAKGNILMLLVWGDGVVLVDPSLR |
Parental | VG |
.G | |
Retrocopy | GG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000016977 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000010006 | 4 retrocopies | |
Myotis lucifugus | ENSMLUG00000010677 | 4 retrocopies | |
Monodelphis domestica | ENSMODG00000007275 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000011088 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000007659 | 6 retrocopies | |
Oreochromis niloticus | ENSONIG00000000370 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000011601 | 6 retrocopies | |
Vicugna pacos | ENSVPAG00000010709 | 2 retrocopies |
retro_vpac_121, retro_vpac_397 ,
|