RetrogeneDB ID: | retro_btau_880 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
Coordinates: | 2:94064787..94065117(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | DSTN | ||
Ensembl ID: | ENSBTAG00000015434 | ||
Aliases: | None | ||
Description: | Destrin [Source:UniProtKB/Swiss-Prot;Acc:Q5E9D5] |
Percent Identity: | 88.18 % |
Parental protein coverage: | 66.67 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | LVGDVGVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASSKDAIK |
LVGDVGVT.TDP.KHFVGMLPEKDC.YALYD..FETKESRKEELMFFLWAPEL.PLKSKMIYASSKDAI. | |
Retrocopy | LVGDVGVTKTDPLKHFVGMLPEKDC*YALYDTGFETKESRKEELMFFLWAPELSPLKSKMIYASSKDAIR |
Parental | KKFQGIKHECQANGPEDLNRACIAEKLGGSLIVAFEGCPV |
.KFQGIKH.CQAN.PE.LNRAC.AEKLGGSLIV.FEGCPV | |
Retrocopy | RKFQGIKHKCQANRPENLNRACTAEKLGGSLIVVFEGCPV |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
ERP005899_liver | 0 .00 RPM | 44 .77 RPM |
ERP005899_muscle | 0 .26 RPM | 172 .30 RPM |
SRP017611_brain | 0 .05 RPM | 92 .91 RPM |
SRP017611_kidney | 0 .00 RPM | 401 .21 RPM |
SRP017611_liver | 0 .00 RPM | 46 .59 RPM |
SRP030211_testis | 0 .02 RPM | 82 .60 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000015434 | 1 retrocopy |
retro_btau_880 ,
|
Bos taurus | ENSBTAG00000021455 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000003110 | 5 retrocopies | |
Cavia porcellus | ENSCPOG00000005573 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000000934 | 1 retrocopy | |
Homo sapiens | ENSG00000125868 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000009007 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000013687 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000013786 | 1 retrocopy | |
Mus musculus | ENSMUSG00000015932 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000009679 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000027456 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000000976 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000010727 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000013275 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000000420 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000005924 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000017634 | 8 retrocopies | |
Tursiops truncatus | ENSTTRG00000007291 | 1 retrocopy |