RetrogeneDB ID: | retro_btau_880 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 2:94064787..94065117(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DSTN | ||
| Ensembl ID: | ENSBTAG00000015434 | ||
| Aliases: | None | ||
| Description: | Destrin [Source:UniProtKB/Swiss-Prot;Acc:Q5E9D5] |
| Percent Identity: | 88.18 % |
| Parental protein coverage: | 66.67 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | LVGDVGVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASSKDAIK |
| LVGDVGVT.TDP.KHFVGMLPEKDC.YALYD..FETKESRKEELMFFLWAPEL.PLKSKMIYASSKDAI. | |
| Retrocopy | LVGDVGVTKTDPLKHFVGMLPEKDC*YALYDTGFETKESRKEELMFFLWAPELSPLKSKMIYASSKDAIR |
| Parental | KKFQGIKHECQANGPEDLNRACIAEKLGGSLIVAFEGCPV |
| .KFQGIKH.CQAN.PE.LNRAC.AEKLGGSLIV.FEGCPV | |
| Retrocopy | RKFQGIKHKCQANRPENLNRACTAEKLGGSLIVVFEGCPV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 44 .77 RPM |
| ERP005899_muscle | 0 .26 RPM | 172 .30 RPM |
| SRP017611_brain | 0 .05 RPM | 92 .91 RPM |
| SRP017611_kidney | 0 .00 RPM | 401 .21 RPM |
| SRP017611_liver | 0 .00 RPM | 46 .59 RPM |
| SRP030211_testis | 0 .02 RPM | 82 .60 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000015434 | 1 retrocopy |
retro_btau_880 ,
|
| Bos taurus | ENSBTAG00000021455 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000003110 | 5 retrocopies | |
| Cavia porcellus | ENSCPOG00000005573 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000000934 | 1 retrocopy | |
| Homo sapiens | ENSG00000125868 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000009007 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000013687 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000013786 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000015932 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000009679 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000027456 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000000976 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000010727 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000013275 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000000420 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000005924 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000017634 | 8 retrocopies | |
| Tursiops truncatus | ENSTTRG00000007291 | 1 retrocopy |