RetrogeneDB ID: | retro_chof_1758 | ||
Retrocopy location | Organism: | Sloth (Choloepus hoffmanni) | |
| Coordinates: | scaffold_377291:312..739(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DSTN | ||
| Ensembl ID: | ENSCHOG00000003110 | ||
| Aliases: | None | ||
| Description: | destrin (actin depolymerizing factor) [Source:HGNC Symbol;Acc:15750] |
| Percent Identity: | 63.27 % |
| Parental protein coverage: | 88.96 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | ASVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKHFV |
| ..V...DEV...F.DMKVRK.ST.E.I..RKKAV.FCLSADK..IIVEE.K.ILVGD.G.T..DP...FV | |
| Retrocopy | SGVTLNDEVVKVFNDMKVRK-STQEGIE-RKKAVLFCLSADKRQIIVEEAKQILVGDIGDTVEDPYTSFV |
| Parental | GMLPEKDCRYALYDASFET-KESRK-EELMFFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGP |
| ...P..DC.YAL.DA..ET.K..RK...L.F..WAPE.APLKSKMIYASSKDAIKKKF.GIKHE...NG. | |
| Retrocopy | KLPPLNDC*YALNDATYET<KSLRK<KDLGFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEGPVNGL |
| Parental | EDLNRAC |
| .D..R.C | |
| Retrocopy | DDIGRQC |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000015434 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000003110 | 5 retrocopies | |
| Cavia porcellus | ENSCPOG00000005573 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000000934 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000011893 | 1 retrocopy | |
| Homo sapiens | ENSG00000125868 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000009007 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000013687 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000013786 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000015932 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000009679 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000027456 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000000976 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000010727 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000013275 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000000420 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000005924 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000007085 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000017634 | 8 retrocopies | |
| Tursiops truncatus | ENSTTRG00000007291 | 1 retrocopy |