RetrogeneDB ID: | retro_sscr_954 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 7:117345551..117345815(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DSTN | ||
| Ensembl ID: | ENSSSCG00000007085 | ||
| Aliases: | None | ||
| Description: | Sus scrofa destrin (actin depolymerizing factor) (DSTN), mRNA. [Source:RefSeq mRNA;Acc:NM_001004031] |
| Percent Identity: | 80.0 % |
| Parental protein coverage: | 53.66 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | KDCRYALYDASFETKESRKEELMFF-LWAPE-LAPLKSKMIYASSKDAIKKKFQGIKHECQANGPEDLNR |
| K.CRYAL.DASFE.KESRK.ELM.F.LWAPE.LAPLKSK.IY.SSKD....KFQ.IKHECQAN.PEDLN. | |
| Retrocopy | KNCRYAL*DASFEIKESRKVELMVF<LWAPE>LAPLKSKKIYVSSKDTTNEKFQAIKHECQANDPEDLNW |
| Parental | ACIAEKLGGSLIVAFEGCPV |
| A.IAEKLGGS.IVAFEGCPV | |
| Retrocopy | A*IAEKLGGSMIVAFEGCPV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 261 .35 RPM |
| SRP014902_testis | 0 .00 RPM | 103 .11 RPM |
| SRP018288_heart | 0 .00 RPM | 221 .07 RPM |
| SRP018288_kidney | 0 .00 RPM | 514 .49 RPM |
| SRP018288_liver | 0 .00 RPM | 88 .27 RPM |
| SRP018288_lung | 0 .00 RPM | 265 .36 RPM |
| SRP018856_adipose | 0 .00 RPM | 171 .14 RPM |
| SRP035408_brain | 0 .00 RPM | 313 .70 RPM |
| SRP035408_liver | 0 .00 RPM | 127 .64 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000003110 | 5 retrocopies | |
| Cavia porcellus | ENSCPOG00000005573 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000000934 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000011893 | 1 retrocopy | |
| Homo sapiens | ENSG00000125868 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000009007 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000013687 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000013786 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000015932 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000009679 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000027456 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000000976 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000010727 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000013275 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000000420 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000005924 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000001959 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000007085 | 1 retrocopy |
retro_sscr_954 ,
|
| Tupaia belangeri | ENSTBEG00000017634 | 8 retrocopies |