RetrogeneDB ID: | retro_sscr_954 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
Coordinates: | 7:117345551..117345815(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | DSTN | ||
Ensembl ID: | ENSSSCG00000007085 | ||
Aliases: | None | ||
Description: | Sus scrofa destrin (actin depolymerizing factor) (DSTN), mRNA. [Source:RefSeq mRNA;Acc:NM_001004031] |
Percent Identity: | 80. % |
Parental protein coverage: | 53.66 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | KDCRYALYDASFETKESRKEELMFF-LWAPE-LAPLKSKMIYASSKDAIKKKFQGIKHECQANGPEDLNR |
K.CRYAL.DASFE.KESRK.ELM.F.LWAPE.LAPLKSK.IY.SSKD....KFQ.IKHECQAN.PEDLN. | |
Retrocopy | KNCRYAL*DASFEIKESRKVELMVF<LWAPE>LAPLKSKKIYVSSKDTTNEKFQAIKHECQANDPEDLNW |
Parental | ACIAEKLGGSLIVAFEGCPV |
A.IAEKLGGS.IVAFEGCPV | |
Retrocopy | A*IAEKLGGSMIVAFEGCPV |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP014902_placenta | 0 .00 RPM | 261 .35 RPM |
SRP014902_testis | 0 .00 RPM | 103 .11 RPM |
SRP018288_heart | 0 .00 RPM | 221 .07 RPM |
SRP018288_kidney | 0 .00 RPM | 514 .49 RPM |
SRP018288_liver | 0 .00 RPM | 88 .27 RPM |
SRP018288_lung | 0 .00 RPM | 265 .36 RPM |
SRP018856_adipose | 0 .00 RPM | 171 .14 RPM |
SRP035408_brain | 0 .00 RPM | 313 .70 RPM |
SRP035408_liver | 0 .00 RPM | 127 .64 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000003110 | 5 retrocopies | |
Cavia porcellus | ENSCPOG00000005573 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000000934 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000011893 | 1 retrocopy | |
Homo sapiens | ENSG00000125868 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000009007 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000013687 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000013786 | 1 retrocopy | |
Mus musculus | ENSMUSG00000015932 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000009679 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000027456 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000000976 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000010727 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000013275 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000000420 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000005924 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000001959 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000007085 | 1 retrocopy |
retro_sscr_954 ,
|
Tupaia belangeri | ENSTBEG00000017634 | 8 retrocopies |